PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast07G102600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YB
Protein Properties Length: 209aa    MW: 22732 Da    PI: 7.5545
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast07G102600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB132.61.2e-41188895
               NF-YB  8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                        +Pi+nv rim++vlP +akis+dake+vqec sefisf+t+ea+++c++e rkti+++d+lwal +lGf+dy++p+++yl++ r++e+
  Brast07G102600.1.p  1 MPITNVNRIMRRVLPPHAKISDDAKELVQECTSEFISFLTGEANEQCHKECRKTISAHDILWALRSLGFNDYIQPVTAYLNRMRDIEN 88
                        8************************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008083.2E-24164IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.103.6E-39188IPR009072Histone-fold
SuperFamilySSF471139.51E-32188IPR009072Histone-fold
PRINTSPR006152.3E-112846No hitNo description
PRINTSPR006152.3E-114765No hitNo description
PRINTSPR006152.3E-116684No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MPITNVNRIM RRVLPPHAKI SDDAKELVQE CTSEFISFLT GEANEQCHKE CRKTISAHDI  60
LWALRSLGFN DYIQPVTAYL NRMRDIENGV VVVNPLPAGP RPPPLPPSAA GSSQGLMQQM  120
QMQMLMQMQM QLGGAMYAPR PPAPVQQQHY AIPAMPMRVR PPFVGGQQGA VFRGNQPMAP  180
YYGGEHLAYG EGSSRGAGDV GDEGSSSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A4e-31185993NF-YB
4awl_B4e-311851094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-311851094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229872.11e-68PREDICTED: nuclear transcription factor Y subunit beta-like
TrEMBLA0A0Q3K2Q11e-68A0A0Q3K2Q1_BRADI; Uncharacterized protein
STRINGBRADI1G43460.18e-68(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2918324
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.24e-42nuclear factor Y, subunit B6